PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_67DE12110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family VOZ
Protein Properties Length: 586aa    MW: 63959.3 Da    PI: 5.1538
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_67DE12110.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ405.41.2e-1242494691217
                    VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne....glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaa 84 
                            p+ps++lgpkcalwdc rp++gse++qdyc+ +ha laln+    g+ gt+pv+rp+gidlkdg+lf+al akvqgk+vgip+c gaa
  Traes_1BL_67DE12110.1 249 PSPSQYLGPKCALWDCGRPVRGSEECQDYCNPYHAGLALNDdgllGTMGTRPVMRPRGIDLKDGPLFDALCAKVQGKNVGIPVCVGAA 336
                            89**************************************96444567899************************************* PP

                    VOZ  85 takspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyey 172
                            t+kspwna elfdlsllege++rewlffd+prrafesgnrkqrslpdy+grgwhesrkqvmk+fgglk+syymdpqpss++ewhl+ey
  Traes_1BL_67DE12110.1 337 TSKSPWNAHELFDLSLLEGESLREWLFFDRPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKKSYYMDPQPSSNYEWHLFEY 424
                            **************************************************************************************** PP

                    VOZ 173 eineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                            ein++++lalyrle+k +d k+s+k+k+ ++sl+++q+++++l+a
  Traes_1BL_67DE12110.1 425 EINDSNTLALYRLEFKASDPKRSVKSKLGSSSLNEIQQQMVKLSA 469
                            *******************************************87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MAGDPTGGGG GSATGKGPRS STRHQQFRDR AKTRVDDLQE IFSGLQSARK ESRSADAAVL  60
EEQVHQMLRE WRAELSVASP ASSLQNSLGN NQGAADPPSE TLRLLQLAIE EEDDATSKLA  120
QPMQPSRQDD HQSLNPGLQV HGGTVDGGAN ASQQSLGHGM QGDCGGEVAD VANALFSDQM  180
YYIDHELSID DFLHGSNPDG LNNQPEHQQF NLPLDLQHSN SSYADANNSV QSTGDVFFHM  240
SDLLTTVSPS PSQYLGPKCA LWDCGRPVRG SEECQDYCNP YHAGLALNDD GLLGTMGTRP  300
VMRPRGIDLK DGPLFDALCA KVQGKNVGIP VCVGAATSKS PWNAHELFDL SLLEGESLRE  360
WLFFDRPRRA FESGNRKQRS LPDYNGRGWH ESRKQVMKDF GGLKKSYYMD PQPSSNYEWH  420
LFEYEINDSN TLALYRLEFK ASDPKRSVKS KLGSSSLNEI QQQMVKLSAN SPVDNKRGAR  480
SKTKATQKDT NANTYPALKT TNQAGASNAY EAVPLNIIPN QASASNAYQA VAPSIPNQDS  540
TSNAYEDASQ VDPMSYLNEN VVYGPHLPYG YPDGKGDFYW NPSGGT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3762940.0AK376294.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3120B09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568104.10.0PREDICTED: transcription factor VOZ1-like
TrEMBLW5A2P50.0W5A2P5_WHEAT; Uncharacterized protein
STRINGBRADI2G19820.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-138vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]